SCOPe 2.03: Domain d2psfb_: 2psf B:

Lineage for d2psfb_ (2psf B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (40 species)
   not a true protein

7. Species Renilla reniformis [TaxId:6136] [225269] (5 PDB entries)

8. Domain d2psfb_: 2psf B: [205627]
   automated match to d2o2ha_

Details for d2psfb_

PDB Entry: 2psf, 1.4 Å

PDB Description: crystal structures of the luciferase and green fluorescent protein from renilla reniformis

PDB Compounds: (B:) Renilla-luciferin 2-monooxygenase

SCOPe Domain Sequences for d2psfb_:

Sequence; same for both SEQRES and ATOM records:

>d2psfb_ c.69.1.0 (B:) automated matches {Renilla reniformis [TaxId: 6136]}
qrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwrhvvphiep
varciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdwgaalafhy
ayehqdrikaivhmesvvdvieswdewpdieedialikseegekmvlennffvetvlpsk
imrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnynaylrasdd
lpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiksfvervlkn
e

Timeline for d2psfb_:

• d2psfb_ is new in SCOPe 2.03-stable
  
• d2psfb_ appears in SCOPe 2.04
  
• d2psfb_ appears in the current release, SCOPe 2.08