SCOP 1.61: Domain d2cd0b_: 2cd0 B:

Lineage for d2cd0b_ (2cd0 B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Bence-Jones VL (lambda) dimer WIL (human) [48928] (1 PDB entry)

8. Domain d2cd0b_: 2cd0 B: [20562]

Details for d2cd0b_

PDB Entry: 2cd0, 1.8 Å

PDB Description: structure of human lambda-6 light chain dimer wil

SCOP Domain Sequences for d2cd0b_:

Sequence; same for both SEQRES and ATOM records:

>d2cd0b_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (lambda) dimer WIL (human)}
nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg

Timeline for d2cd0b_:

• d2cd0b_ first appeared (with stable ids) in SCOP 1.55
  
• d2cd0b_ appears in SCOP 1.59
  
• d2cd0b_ appears in SCOP 1.63
  
• d2cd0b_ appears in the current release, SCOPe 2.08