Lineage for d2cd0b_ (2cd0 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51914Species Bence-Jones VL (lambda) dimer WIL (human) [48928] (1 PDB entry)
  8. 51916Domain d2cd0b_: 2cd0 B: [20562]

Details for d2cd0b_

PDB Entry: 2cd0 (more details), 1.8 Å

PDB Description: structure of human lambda-6 light chain dimer wil

SCOP Domain Sequences for d2cd0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cd0b_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (lambda) dimer WIL (human)}
nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg

SCOP Domain Coordinates for d2cd0b_:

Click to download the PDB-style file with coordinates for d2cd0b_.
(The format of our PDB-style files is described here.)

Timeline for d2cd0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cd0a_