SCOPe 2.08: Domain d2ps2d1: 2ps2 D:3-130

Lineage for d2ps2d1 (2ps2 D:3-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Aspergillus oryzae [TaxId:510516] [225270] (1 PDB entry)

8. Domain d2ps2d1: 2ps2 D:3-130 [205610]
   Other proteins in same PDB: d2ps2a2, d2ps2b2, d2ps2c2, d2ps2d2
   automated match to d1jpma2
   complexed with mg

Details for d2ps2d1

PDB Entry: 2ps2, 1.8 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from aspergillus oryzae

PDB Compounds: (D:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2ps2d1:

Sequence, based on SEQRES records:

>d2ps2d1 d.54.1.0 (D:3-130) automated matches {Aspergillus oryzae [TaxId: 510516]}
dlkiaridvfqvdlpysggvyylsagreyrsfdativrittdtgiegwgestpfgsnyia
shprgvragiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvgl
pvcellgg

Sequence, based on observed residues (ATOM records):

>d2ps2d1 d.54.1.0 (D:3-130) automated matches {Aspergillus oryzae [TaxId: 510516]}
dlkiaridvfqvdlpysggvyylsfdativrittdtgiegwgestpfgsnyiashprgvr
agiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvglpvcellg
g

Timeline for d2ps2d1:

• d2ps2d1 first appeared in SCOPe 2.03
  
• d2ps2d1 appears in SCOPe 2.07