Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (55 species) not a true protein |
Species Aspergillus oryzae [TaxId:510516] [225270] (1 PDB entry) |
Domain d2ps2c1: 2ps2 C:3-130 [205608] Other proteins in same PDB: d2ps2a2, d2ps2b2, d2ps2c2, d2ps2d2 automated match to d1jpma2 complexed with mg |
PDB Entry: 2ps2 (more details), 1.8 Å
SCOPe Domain Sequences for d2ps2c1:
Sequence, based on SEQRES records: (download)
>d2ps2c1 d.54.1.0 (C:3-130) automated matches {Aspergillus oryzae [TaxId: 510516]} dlkiaridvfqvdlpysggvyylsagreyrsfdativrittdtgiegwgestpfgsnyia shprgvragiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvgl pvcellgg
>d2ps2c1 d.54.1.0 (C:3-130) automated matches {Aspergillus oryzae [TaxId: 510516]} dlkiaridvfqvdlpysggvyylsfdativrittdtgiegwgestpfgsnyiashprgvr agiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvglpvcellg g
Timeline for d2ps2c1: