SCOPe 2.06: Domain d2ppyd_: 2ppy D:

Lineage for d2ppyd_ (2ppy D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [193499] (3 PDB entries)

8. Domain d2ppyd_: 2ppy D: [205593]
   automated match to d2uzfa_
   complexed with edo, peg

Details for d2ppyd_

PDB Entry: 2ppy, 2.16 Å

PDB Description: Crystal structure of Enoyl-CoA hydrates (gk_1992) from Geobacillus Kaustophilus HTA426

PDB Compounds: (D:) enoyl-coa hydratase

SCOPe Domain Sequences for d2ppyd_:

Sequence; same for both SEQRES and ATOM records:

>d2ppyd_ c.14.1.0 (D:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
tavetkkqyltvfkedgiaeihlhinksnsydlefykefnaaiddirfdpdikvvivmsd
vpkffsagadinflrsadprfktqfclfcnetldkiarspqvyiacleghtvggglemal
acdlrfmgdeagkiglpevslgvlagtggtqrlarligysraldmnitgetitpqealei
glvnrvfpqaetrertreyarklansatyavsniklaimngkemplnvairyegelqnll
frsedakeglsaflekrqpnwkgi

Timeline for d2ppyd_:

• d2ppyd_ first appeared in SCOPe 2.03
  
• d2ppyd_ appears in SCOPe 2.05
  
• d2ppyd_ appears in SCOPe 2.07
  
• d2ppyd_ appears in the current release, SCOPe 2.08