Lineage for d1cd0a_ (1cd0 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Bence-Jones VL (lambda) dimer JTO (human) [48927] (1 PDB entry) 
Domain d1cd0a_: 1cd0 A: [20559]
Details for d1cd0a_
PDB Entry: 1cd0 (more details), 1.9 Å
PDB Description: structure of human lamda-6 light chain dimer jto
SCOP Domain Sequences for d1cd0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (lambda) dimer JTO (human)}
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
SCOP Domain Coordinates for d1cd0a_:
Click to download the PDB-style file with coordinates for d1cd0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cd0a_:
- d1cd0a_ appears in SCOP 1.57
- d1cd0a_ appears in the current release, SCOPe 2.08
View in 3D
