Lineage for d2pozc1 (2poz C:3-118)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413159Species Mesorhizobium loti [TaxId:266835] [225266] (1 PDB entry)
  8. 1413162Domain d2pozc1: 2poz C:3-118 [205575]
    Other proteins in same PDB: d2poza2, d2pozb2, d2pozc2, d2pozd2, d2poze2, d2pozf2, d2pozg2, d2pozh2
    automated match to d2gl5a2

Details for d2pozc1

PDB Entry: 2poz (more details), 2.04 Å

PDB Description: Crystal structure of a putative dehydratase from Mesorhizobium loti
PDB Compounds: (C:) Putative dehydratase

SCOPe Domain Sequences for d2pozc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pozc1 d.54.1.0 (C:3-118) automated matches {Mesorhizobium loti [TaxId: 266835]}
lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfgg

SCOPe Domain Coordinates for d2pozc1:

Click to download the PDB-style file with coordinates for d2pozc1.
(The format of our PDB-style files is described here.)

Timeline for d2pozc1: