Lineage for d1lila1 (1lil A:2-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 452262Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 452339Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (3 PDB entries)
  8. 452342Domain d1lila1: 1lil A:2-107 [20557]
    Other proteins in same PDB: d1lila2, d1lilb2

Details for d1lila1

PDB Entry: 1lil (more details), 2.65 Å

PDB Description: bence jones protein cle, a lambda iii immunoglobulin light-chain dimer

SCOP Domain Sequences for d1lila1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lila1 b.1.1.1 (A:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5}
yevtqppslsvspgqtaritcsgeklgdayvcwyqqrpgqspvvviyqdnrrpsgiperf
sgsssgntatltisgtqtldeadyycqvwdsnasvvfgggtkltvlg

SCOP Domain Coordinates for d1lila1:

Click to download the PDB-style file with coordinates for d1lila1.
(The format of our PDB-style files is described here.)

Timeline for d1lila1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lila2