SCOPe 2.06: Domain d2po2a2: 2po2 A:154-244

Lineage for d2po2a2 (2po2 A:154-244)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [225428] (4 PDB entries)

8. Domain d2po2a2: 2po2 A:154-244 [205566]
   Other proteins in same PDB: d2po2a1, d2po2b1
   automated match to d2nn6b2
   complexed with cdp, mpd

Details for d2po2a2

PDB Entry: 2po2, 2.41 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with CDP

PDB Compounds: (A:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2po2a2:

Sequence; same for both SEQRES and ATOM records:

>d2po2a2 d.101.1.0 (A:154-244) automated matches {Pyrococcus abyssi [TaxId: 29292]}
pmrdlvaacaagkiegeivldlnkeednygeadvpvaimplknditllqmdgyltkdefi
eavklaikgakavyqkqrealkekylkiaqe

Timeline for d2po2a2:

• d2po2a2 first appeared in SCOPe 2.03
  
• d2po2a2 appears in SCOPe 2.05
  
• d2po2a2 appears in SCOPe 2.07
  
• d2po2a2 appears in the current release, SCOPe 2.08