Lineage for d2po2a2 (2po2 A:154-244)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920395Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1920396Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1920548Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 1920549Protein automated matches [226956] (5 species)
    not a true protein
  7. 1920566Species Pyrococcus abyssi [TaxId:29292] [225428] (4 PDB entries)
  8. 1920573Domain d2po2a2: 2po2 A:154-244 [205566]
    Other proteins in same PDB: d2po2a1, d2po2b1
    automated match to d2nn6b2
    complexed with cdp, mpd

Details for d2po2a2

PDB Entry: 2po2 (more details), 2.41 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with CDP
PDB Compounds: (A:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2po2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2po2a2 d.101.1.0 (A:154-244) automated matches {Pyrococcus abyssi [TaxId: 29292]}
pmrdlvaacaagkiegeivldlnkeednygeadvpvaimplknditllqmdgyltkdefi
eavklaikgakavyqkqrealkekylkiaqe

SCOPe Domain Coordinates for d2po2a2:

Click to download the PDB-style file with coordinates for d2po2a2.
(The format of our PDB-style files is described here.)

Timeline for d2po2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2po2a1