SCOPe 2.04: Domain d2po2a1: 2po2 A:9-153

Lineage for d2po2a1 (2po2 A:9-153)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (16 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [225427] (4 PDB entries)

8. Domain d2po2a1: 2po2 A:9-153 [205565]
   Other proteins in same PDB: d2po2a2, d2po2b2
   automated match to d2nn6b1
   complexed with cdp, mpd

Details for d2po2a1

PDB Entry: 2po2, 2.41 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with CDP

PDB Compounds: (A:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2po2a1:

Sequence; same for both SEQRES and ATOM records:

>d2po2a1 d.14.1.0 (A:9-153) automated matches {Pyrococcus abyssi [TaxId: 29292]}
klidengrridgrkkyelrpikmevgvlknangsayiewgknkiiaavygprelhpkhlq
rpdrailrvrynmapfsveerkkpgpdrrsieiskvikgalepalilemfprtaidvfie
vlqadagtrvagitaaslaladagi

Timeline for d2po2a1:

• d2po2a1 first appeared in SCOPe 2.03
  
• d2po2a1 appears in SCOPe 2.05
  
• d2po2a1 appears in the current release, SCOPe 2.08