Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) |
Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
Protein automated matches [226956] (5 species) not a true protein |
Species Pyrococcus abyssi [TaxId:29292] [225428] (4 PDB entries) |
Domain d2po1a2: 2po1 A:154-244 [205564] Other proteins in same PDB: d2po1a1, d2po1b1 automated match to d2nn6b2 protein/RNA complex; complexed with mpd |
PDB Entry: 2po1 (more details), 1.94 Å
SCOPe Domain Sequences for d2po1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2po1a2 d.101.1.0 (A:154-244) automated matches {Pyrococcus abyssi [TaxId: 29292]} pmrdlvaacaagkiegeivldlnkeednygeadvpvaimplknditllqmdgyltkdefi eavklaikgakavyqkqrealkekylkiaqe
Timeline for d2po1a2: