![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) ![]() |
![]() | Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
![]() | Protein automated matches [226956] (4 species) not a true protein |
![]() | Species Pyrococcus abyssi [TaxId:29292] [225428] (4 PDB entries) |
![]() | Domain d2pnza2: 2pnz A:154-244 [205560] Other proteins in same PDB: d2pnza1 automated match to d2nn6b2 complexed with 5gp, mpd, udp |
PDB Entry: 2pnz (more details), 2.14 Å
SCOPe Domain Sequences for d2pnza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pnza2 d.101.1.0 (A:154-244) automated matches {Pyrococcus abyssi [TaxId: 29292]} pmrdlvaacaagkiegeivldlnkeednygeadvpvaimplknditllqmdgyltkdefi eavklaikgakavyqkqrealkekylkiaqe
Timeline for d2pnza2: