SCOP 1.69: Domain d4lveb_: 4lve B:

Lineage for d4lveb_ (4lve B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d4lveb_: 4lve B: [20555]
   VL dimer of Bence-Jones protein LEN

Details for d4lveb_

PDB Entry: 4lve, 2.3 Å

PDB Description: len k30t mutant: a domain flip as a result of a single amino acid substitution

SCOP Domain Sequences for d4lveb_:

Sequence; same for both SEQRES and ATOM records:

>d4lveb_ b.1.1.1 (B:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2}
divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik

Timeline for d4lveb_:

• d4lveb_ first appeared (with stable ids) in SCOP 1.55
  
• d4lveb_ appears in SCOP 1.67
  
• d4lveb_ appears in SCOP 1.71
  
• d4lveb_ appears in the current release, SCOPe 2.08