SCOP 1.61: Domain d4lveb_: 4lve B:

Lineage for d4lveb_ (4lve B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)

8. Domain d4lveb_: 4lve B: [20555]

Details for d4lveb_

PDB Entry: 4lve, 2.3 Å

PDB Description: len k30t mutant: a domain flip as a result of a single amino acid substitution

SCOP Domain Sequences for d4lveb_:

Sequence; same for both SEQRES and ATOM records:

>d4lveb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik

Timeline for d4lveb_:

• d4lveb_ first appeared (with stable ids) in SCOP 1.55
  
• d4lveb_ appears in SCOP 1.59
  
• d4lveb_ appears in SCOP 1.63
  
• d4lveb_ appears in the current release, SCOPe 2.08