Lineage for d4lveb_ (4lve B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7236Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)
  8. 7248Domain d4lveb_: 4lve B: [20555]

Details for d4lveb_

PDB Entry: 4lve (more details), 2.3 Å

PDB Description: len k30t mutant: a domain flip as a result of a single amino acid substitution

SCOP Domain Sequences for d4lveb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lveb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik

SCOP Domain Coordinates for d4lveb_:

Click to download the PDB-style file with coordinates for d4lveb_.
(The format of our PDB-style files is described here.)

Timeline for d4lveb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4lvea_