Lineage for d2pl3a_ (2pl3 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366245Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries)
  8. 1366315Domain d2pl3a_: 2pl3 A: [205541]
    automated match to d1wrbb_
    protein/RNA complex; complexed with adp, eoh, mg

Details for d2pl3a_

PDB Entry: 2pl3 (more details), 2.15 Å

PDB Description: human dead-box rna helicase ddx10, dead domain in complex with adp
PDB Compounds: (A:) Probable ATP-dependent RNA helicase DDX10

SCOPe Domain Sequences for d2pl3a_:

Sequence, based on SEQRES records: (download)

>d2pl3a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smqveresisrlmqnyekinvneitrfsdfplskktlkglqeaqyrlvteiqkqtiglal
qgkdvlgaaktgsgktlaflvpvlealyrlqwtstdglgvliisptrelayqtfevlrkv
gknhdfsagliiggkdlkheaerinninilvctpgrllqhmdetvsfhatdlqmlvldea
drildmgfadtmnavienlpkkrqtllfsatqtksvkdlarlslknpeyvwvhe

Sequence, based on observed residues (ATOM records): (download)

>d2pl3a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smqveresisrlmqnyekinvneitrfsdfplskktlkglqeaqyrlvteiqkqtiglal
qgkdvlgaaktgsgktlaflvpvlealyrlqwtstdglgvliisptrelayqtfevlrkv
gknhdfsagliigglkheaerinninilvctpgrllqhmdetvsfhatdlqmlvldeadr
ildmgfadtmnavienlpkkrqtllfsatqtksvkdlarlslknpeyvwvhe

SCOPe Domain Coordinates for d2pl3a_:

Click to download the PDB-style file with coordinates for d2pl3a_.
(The format of our PDB-style files is described here.)

Timeline for d2pl3a_: