SCOP 1.73: Domain d4lvea_: 4lve A:

Lineage for d4lvea_ (4lve A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d4lvea_: 4lve A: [20554]

Details for d4lvea_

PDB Entry: 4lve, 2.3 Å

PDB Description: len k30t mutant: a domain flip as a result of a single amino acid substitution

PDB Compounds: (A:) len

SCOP Domain Sequences for d4lvea_:

Sequence; same for both SEQRES and ATOM records:

>d4lvea_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

Timeline for d4lvea_:

• d4lvea_ first appeared (with stable ids) in SCOP 1.55
  
• d4lvea_ appears in SCOP 1.71
  
• d4lvea_ appears in SCOP 1.75
  
• d4lvea_ appears in the current release, SCOPe 2.08