Lineage for d4lvea_ (4lve A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451707Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)
  8. 451720Domain d4lvea_: 4lve A: [20554]

Details for d4lvea_

PDB Entry: 4lve (more details), 2.3 Å

PDB Description: len k30t mutant: a domain flip as a result of a single amino acid substitution

SCOP Domain Sequences for d4lvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lvea_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2}
divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

SCOP Domain Coordinates for d4lvea_:

Click to download the PDB-style file with coordinates for d4lvea_.
(The format of our PDB-style files is described here.)

Timeline for d4lvea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4lveb_