SCOP 1.63: Domain d4lvea_: 4lve A:

Lineage for d4lvea_ (4lve A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)

8. Domain d4lvea_: 4lve A: [20554]

Details for d4lvea_

PDB Entry: 4lve, 2.3 Å

PDB Description: len k30t mutant: a domain flip as a result of a single amino acid substitution

SCOP Domain Sequences for d4lvea_:

Sequence; same for both SEQRES and ATOM records:

>d4lvea_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

Timeline for d4lvea_:

• d4lvea_ first appeared (with stable ids) in SCOP 1.55
  
• d4lvea_ appears in SCOP 1.61
  
• d4lvea_ appears in SCOP 1.65
  
• d4lvea_ appears in the current release, SCOPe 2.08