Lineage for d1lvea_ (1lve A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782762Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)
  8. 782774Domain d1lvea_: 1lve A: [20553]
    VL dimer of Bence-Jones protein LEN

Details for d1lvea_

PDB Entry: 1lve (more details), 1.95 Å

PDB Description: structure of the variable domain of human immunoglobulin k-4 light chain len
PDB Compounds: (A:) len, a variable domain from kappa-4 type

SCOP Domain Sequences for d1lvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvea_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

SCOP Domain Coordinates for d1lvea_:

Click to download the PDB-style file with coordinates for d1lvea_.
(The format of our PDB-style files is described here.)

Timeline for d1lvea_: