SCOP 1.65: Domain d1lve__: 1lve -

Lineage for d1lve__ (1lve -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d1lve__: 1lve - [20553]
   VL dimer of Bence-Jones protein LEN

Details for d1lve__

PDB Entry: 1lve, 1.95 Å

PDB Description: structure of the variable domain of human immunoglobulin k-4 light chain len

SCOP Domain Sequences for d1lve__:

Sequence; same for both SEQRES and ATOM records:

>d1lve__ b.1.1.1 (-) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

Timeline for d1lve__:

• d1lve__ first appeared (with stable ids) in SCOP 1.55
  
• d1lve__ appears in SCOP 1.63
  
• d1lve__ appears in SCOP 1.67
  
• d1lve__ appears in the current release, SCOPe 2.08, called d1lvea_