Lineage for d1lve__ (1lve -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7236Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)
  8. 7246Domain d1lve__: 1lve - [20553]

Details for d1lve__

PDB Entry: 1lve (more details), 1.95 Å

PDB Description: structure of the variable domain of human immunoglobulin k-4 light chain len

SCOP Domain Sequences for d1lve__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lve__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

SCOP Domain Coordinates for d1lve__:

Click to download the PDB-style file with coordinates for d1lve__.
(The format of our PDB-style files is described here.)

Timeline for d1lve__: