Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (26 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [225263] (1 PDB entry) |
Domain d2pg0b2: 2pg0 B:236-384 [205522] Other proteins in same PDB: d2pg0a1, d2pg0b1 automated match to d1ivha1 complexed with fad |
PDB Entry: 2pg0 (more details), 1.8 Å
SCOPe Domain Sequences for d2pg0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pg0b2 a.29.3.0 (B:236-384) automated matches {Geobacillus kaustophilus [TaxId: 235909]} kgfyylmeklqqerlvvaiaaqtaaevmfsltkqyvkqrtafgkrvsefqtvqfrlaema teialgrtfvdrvieehmagkqivtevsmakwwitemakrvaaeamqlhggygymeeyei arryrdipvsaiyagtnemmktiiarqld
Timeline for d2pg0b2: