Lineage for d2pg0b2 (2pg0 B:236-384)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1994829Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1994963Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1994964Protein automated matches [226935] (26 species)
    not a true protein
  7. 1995078Species Geobacillus kaustophilus [TaxId:235909] [225263] (1 PDB entry)
  8. 1995080Domain d2pg0b2: 2pg0 B:236-384 [205522]
    Other proteins in same PDB: d2pg0a1, d2pg0b1
    automated match to d1ivha1
    complexed with fad

Details for d2pg0b2

PDB Entry: 2pg0 (more details), 1.8 Å

PDB Description: crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2pg0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pg0b2 a.29.3.0 (B:236-384) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
kgfyylmeklqqerlvvaiaaqtaaevmfsltkqyvkqrtafgkrvsefqtvqfrlaema
teialgrtfvdrvieehmagkqivtevsmakwwitemakrvaaeamqlhggygymeeyei
arryrdipvsaiyagtnemmktiiarqld

SCOPe Domain Coordinates for d2pg0b2:

Click to download the PDB-style file with coordinates for d2pg0b2.
(The format of our PDB-style files is described here.)

Timeline for d2pg0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pg0b1