Lineage for d2pg0b1 (2pg0 B:8-235)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1691655Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1691656Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1691797Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1691798Protein automated matches [226934] (17 species)
    not a true protein
  7. 1691859Species Geobacillus kaustophilus [TaxId:235909] [225262] (1 PDB entry)
  8. 1691861Domain d2pg0b1: 2pg0 B:8-235 [205521]
    Other proteins in same PDB: d2pg0a2, d2pg0b2
    automated match to d1ivha2
    complexed with fad

Details for d2pg0b1

PDB Entry: 2pg0 (more details), 1.8 Å

PDB Description: crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2pg0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pg0b1 e.6.1.0 (B:8-235) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
rylreehhmfraafrkflekeayphyndwekrgiiprsfwakmgengflcpwvdekyggl
nadfaysvvineelekvgsslvgiglhndivtpyiasygteeqkqkwlpkcvtgelitai
amtepgagsdlanisttavkdgdyyivngqktfitngihadlivvacktdpqakpphrgi
sllvverdtpgftrgrklekvglhaqdtaelffqdakvpaynllgeeg

SCOPe Domain Coordinates for d2pg0b1:

Click to download the PDB-style file with coordinates for d2pg0b1.
(The format of our PDB-style files is described here.)

Timeline for d2pg0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pg0b2