Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (14 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [225262] (1 PDB entry) |
Domain d2pg0b1: 2pg0 B:8-235 [205521] Other proteins in same PDB: d2pg0a2, d2pg0b2 automated match to d1ivha2 complexed with fad |
PDB Entry: 2pg0 (more details), 1.8 Å
SCOPe Domain Sequences for d2pg0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pg0b1 e.6.1.0 (B:8-235) automated matches {Geobacillus kaustophilus [TaxId: 235909]} rylreehhmfraafrkflekeayphyndwekrgiiprsfwakmgengflcpwvdekyggl nadfaysvvineelekvgsslvgiglhndivtpyiasygteeqkqkwlpkcvtgelitai amtepgagsdlanisttavkdgdyyivngqktfitngihadlivvacktdpqakpphrgi sllvverdtpgftrgrklekvglhaqdtaelffqdakvpaynllgeeg
Timeline for d2pg0b1: