Lineage for d3lvea_ (3lve A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511530Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)
  8. 1511540Domain d3lvea_: 3lve A: [20552]
    VL dimer of Bence-Jones protein LEN
    complexed with zn; mutant

Details for d3lvea_

PDB Entry: 3lve (more details), 2 Å

PDB Description: len q38e mutant: a domain flip from a single amino acid substitution
PDB Compounds: (A:) len

SCOPe Domain Sequences for d3lvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lvea_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqekpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

SCOPe Domain Coordinates for d3lvea_:

Click to download the PDB-style file with coordinates for d3lvea_.
(The format of our PDB-style files is described here.)

Timeline for d3lvea_: