Lineage for d3lve__ (3lve -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) 
Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries) 
Domain d3lve__: 3lve - [20552]
Details for d3lve__
PDB Entry: 3lve (more details), 2 Å
PDB Description: len q38e mutant: a domain flip from a single amino acid substitution
SCOP Domain Sequences for d3lve__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lve__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqekpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr
SCOP Domain Coordinates for d3lve__:
Click to download the PDB-style file with coordinates for d3lve__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lve__:
- d3lve__ first appeared (with stable ids) in SCOP 1.55
- d3lve__ appears in SCOP 1.59
- d3lve__ appears in SCOP 1.63
- d3lve__ appears in the current release, SCOPe 2.08, called d3lvea_
View in 3D