Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries) |
Domain d3lve__: 3lve - [20552] |
PDB Entry: 3lve (more details), 2 Å
SCOP Domain Sequences for d3lve__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lve__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)} divmtqspdslavslgeratinckssqsvlyssnsknylawyqekpgqppklliywastr esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr
Timeline for d3lve__: