Lineage for d3lve__ (3lve -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51895Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)
  8. 51903Domain d3lve__: 3lve - [20552]

Details for d3lve__

PDB Entry: 3lve (more details), 2 Å

PDB Description: len q38e mutant: a domain flip from a single amino acid substitution

SCOP Domain Sequences for d3lve__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lve__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqekpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

SCOP Domain Coordinates for d3lve__:

Click to download the PDB-style file with coordinates for d3lve__.
(The format of our PDB-style files is described here.)

Timeline for d3lve__: