SCOPe 2.05: Domain d2pg0a1: 2pg0 A:6-235

Lineage for d2pg0a1 (2pg0 A:6-235)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (20 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [225262] (1 PDB entry)

8. Domain d2pg0a1: 2pg0 A:6-235 [205519]
   Other proteins in same PDB: d2pg0a2, d2pg0b2
   automated match to d1ivha2
   complexed with fad

Details for d2pg0a1

PDB Entry: 2pg0, 1.8 Å

PDB Description: crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus

PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2pg0a1:

Sequence; same for both SEQRES and ATOM records:

>d2pg0a1 e.6.1.0 (A:6-235) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
tarylreehhmfraafrkflekeayphyndwekrgiiprsfwakmgengflcpwvdekyg
glnadfaysvvineelekvgsslvgiglhndivtpyiasygteeqkqkwlpkcvtgelit
aiamtepgagsdlanisttavkdgdyyivngqktfitngihadlivvacktdpqakpphr
gisllvverdtpgftrgrklekvglhaqdtaelffqdakvpaynllgeeg

Timeline for d2pg0a1:

• d2pg0a1 first appeared in SCOPe 2.03
  
• d2pg0a1 appears in SCOPe 2.04
  
• d2pg0a1 appears in SCOPe 2.06
  
• d2pg0a1 appears in the current release, SCOPe 2.08