SCOPe 2.04: Domain d2pe8a_: 2pe8 A:

Lineage for d2pe8a_ (2pe8 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (59 PDB entries)

8. Domain d2pe8a_: 2pe8 A: [205511]
   automated match to d2dita1

Details for d2pe8a_

PDB Entry: 2pe8, 2 Å

PDB Description: Crystal structure of the UHM domain of human SPF45 (free form)

PDB Compounds: (A:) Splicing factor 45

SCOPe Domain Sequences for d2pe8a_:

Sequence, based on SEQRES records:

>d2pe8a_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgkcptkvvllrnmvgagevdedlevetkeecekygkvgkcvifeipgapddeavrifl
efervesaikavvdlngryfggrvvkacfynldkfrvldlaeqv

Sequence, based on observed residues (ATOM records):

>d2pe8a_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgkcptkvvllrnmvgagevlevetkeecekygkvgkcvifeipgapddeavriflefe
rvesaikavvdlngryfggrvvkacfynldkfrvldlaeqv

Timeline for d2pe8a_:

• d2pe8a_ first appeared in SCOPe 2.03
  
• d2pe8a_ appears in SCOPe 2.05
  
• d2pe8a_ appears in the current release, SCOPe 2.08, called d2pe8a1