SCOPe 2.05: Domain d5lvea_: 5lve A:

Lineage for d5lvea_ (5lve A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d5lvea_: 5lve A: [20551]
   VL dimer of Bence-Jones protein LEN
   complexed with zn

Details for d5lvea_

PDB Entry: 5lve, 2 Å

PDB Description: structure of the variable domain of human immunoglobulin k-4 light chain len

PDB Compounds: (A:) bence-jones protein len

SCOPe Domain Sequences for d5lvea_:

Sequence; same for both SEQRES and ATOM records:

>d5lvea_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycaqyystpysfgqgtkleikr

Timeline for d5lvea_:

• d5lvea_ first appeared (with stable ids) in SCOP 1.55
  
• d5lvea_ appears in SCOPe 2.04
  
• d5lvea_ appears in SCOPe 2.06
  
• d5lvea_ appears in the current release, SCOPe 2.08