Lineage for d5lvea_ (5lve A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7236Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)
  8. Domain d5lvea_: 5lve A: [20551]

Details for d5lvea_

PDB Entry: 5lve (more details), 2 Å

PDB Description: structure of the variable domain of human immunoglobulin k-4 light chain len

SCOP Domain Sequences for d5lvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lvea_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycaqyystpysfgqgtkleikr

SCOP Domain Coordinates for d5lvea_ are not available.

Timeline for d5lvea_: