SCOPe 2.03: Domain d2pcee2: 2pce E:128-372

Lineage for d2pcee2 (2pce E:128-372)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Roseovarius nubinhibens [TaxId:89187] [225251] (4 PDB entries)

8. Domain d2pcee2: 2pce E:128-372 [205504]
   Other proteins in same PDB: d2pcea1, d2pceb1, d2pcec1, d2pced1, d2pcee1, d2pcef1, d2pceg1, d2pceh1
   automated match to d1jpma1
   complexed with po4

Details for d2pcee2

PDB Entry: 2pce, 2 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism

PDB Compounds: (E:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pcee2:

Sequence; same for both SEQRES and ATOM records:

>d2pcee2 c.1.11.0 (E:128-372) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
rvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacla
drqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalpllld
eliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisf
aailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnrdalgt
pvktf

Timeline for d2pcee2:

• d2pcee2 is new in SCOPe 2.03-stable
  
• d2pcee2 appears in SCOPe 2.04
  
• d2pcee2 appears in the current release, SCOPe 2.08