SCOPe 2.06: Domain d2pcec1: 2pce C:2-127

Lineage for d2pcec1 (2pce C:2-127)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)

8. Domain d2pcec1: 2pce C:2-127 [205499]
   Other proteins in same PDB: d2pcea2, d2pcea3, d2pceb2, d2pceb3, d2pcec2, d2pcec3, d2pced2, d2pced3, d2pcee2, d2pcee3, d2pcef2, d2pcef3, d2pceg2, d2pceg3, d2pceh2, d2pceh3
   automated match to d1jpma2
   complexed with po4

Details for d2pcec1

PDB Entry: 2pce, 2 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism

PDB Compounds: (C:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pcec1:

Sequence; same for both SEQRES and ATOM records:

>d2pcec1 d.54.1.0 (C:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
kitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaah
aggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglpl
cdmtgg

Timeline for d2pcec1:

• d2pcec1 first appeared in SCOPe 2.03
  
• d2pcec1 appears in SCOPe 2.05
  
• d2pcec1 appears in SCOPe 2.07
  
• d2pcec1 appears in the current release, SCOPe 2.08