Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Roseovarius nubinhibens [TaxId:89187] [225251] (5 PDB entries) |
Domain d2pceb2: 2pce B:128-372 [205498] Other proteins in same PDB: d2pcea1, d2pcea3, d2pceb1, d2pceb3, d2pcec1, d2pcec3, d2pced1, d2pced3, d2pcee1, d2pcee3, d2pcef1, d2pcef3, d2pceg1, d2pceg3, d2pceh1, d2pceh3 automated match to d1jpma1 complexed with po4 |
PDB Entry: 2pce (more details), 2 Å
SCOPe Domain Sequences for d2pceb2:
Sequence, based on SEQRES records: (download)
>d2pceb2 c.1.11.0 (B:128-372) automated matches {Roseovarius nubinhibens [TaxId: 89187]} rvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacla drqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalpllld eliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisf aailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnrdalgt pvktf
>d2pceb2 c.1.11.0 (B:128-372) automated matches {Roseovarius nubinhibens [TaxId: 89187]} rvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacla drqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalpllld eliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisf aailhlaqstprhllrcaldtramttaelaeidapldggasapsdpglglrvnrdalgtp vktf
Timeline for d2pceb2: