SCOPe 2.01: Domain d1efqa_: 1efq A:

Lineage for d1efqa_ (1efq A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d1efqa_: 1efq A: [20548]
   VL dimer of Bence-Jones protein LEN
   complexed with ium, zn; mutant

Details for d1efqa_

PDB Entry: 1efq, 1.6 Å

PDB Description: q38d mutant of len

PDB Compounds: (A:) kappa-4 immunoglobulin (light chain)

SCOPe Domain Sequences for d1efqa_:

Sequence; same for both SEQRES and ATOM records:

>d1efqa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqdkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik

Timeline for d1efqa_:

• d1efqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1efqa_ appears in SCOP 1.75
  
• d1efqa_ appears in SCOPe 2.02
  
• d1efqa_ appears in the current release, SCOPe 2.08