SCOP 1.63: Domain d1efqa_: 1efq A:

Lineage for d1efqa_ (1efq A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)

8. Domain d1efqa_: 1efq A: [20548]
   complexed with ium, zn; mutant

Details for d1efqa_

PDB Entry: 1efq, 1.6 Å

PDB Description: q38d mutant of len

SCOP Domain Sequences for d1efqa_:

Sequence; same for both SEQRES and ATOM records:

>d1efqa_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqdkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik

Timeline for d1efqa_:

• d1efqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1efqa_ appears in SCOP 1.61
  
• d1efqa_ appears in SCOP 1.65
  
• d1efqa_ appears in the current release, SCOPe 2.08