SCOPe 2.05: Domain d2p88g2: 2p88 G:126-369

Lineage for d2p88g2 (2p88 G:126-369)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [225290] (3 PDB entries)

8. Domain d2p88g2: 2p88 G:126-369 [205474]
   Other proteins in same PDB: d2p88a1, d2p88b1, d2p88c1, d2p88d1, d2p88e1, d2p88f1, d2p88g1, d2p88h1
   automated match to d1nu5a1
   complexed with mg

Details for d2p88g2

PDB Entry: 2p88, 2.4 Å

PDB Description: Crystal structure of N-succinyl Arg/Lys racemase from Bacillus cereus ATCC 14579

PDB Compounds: (G:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d2p88g2:

Sequence; same for both SEQRES and ATOM records:

>d2p88g2 c.1.11.0 (G:126-369) automated matches {Bacillus cereus [TaxId: 226900]}
ryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavrervgnd
iairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlplmideg
lkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvessvassa
gfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqeltvfq
divr

Timeline for d2p88g2:

• d2p88g2 first appeared in SCOPe 2.03
  
• d2p88g2 appears in SCOPe 2.04
  
• d2p88g2 appears in SCOPe 2.06
  
• d2p88g2 appears in the current release, SCOPe 2.08