SCOP 1.59: Domain d1eeub_: 1eeu B:

Lineage for d1eeub_ (1eeu B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)

8. Domain d1eeub_: 1eeu B: [20547]

Details for d1eeub_

PDB Entry: 1eeu, 1.6 Å

PDB Description: m4l/y(27d)d/q89d/t94h mutant of len

SCOP Domain Sequences for d1eeub_:

Sequence; same for both SEQRES and ATOM records:

>d1eeub_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtkleik

Timeline for d1eeub_:

• d1eeub_ first appeared (with stable ids) in SCOP 1.55
  
• d1eeub_ appears in SCOP 1.57
  
• d1eeub_ appears in SCOP 1.61
  
• d1eeub_ appears in the current release, SCOPe 2.08