Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries) |
Domain d1eeub_: 1eeu B: [20547] |
PDB Entry: 1eeu (more details), 1.6 Å
SCOP Domain Sequences for d1eeub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eeub_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)} divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtkleik
Timeline for d1eeub_: