Lineage for d1eeua_ (1eeu A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756745Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)
  8. 1756748Domain d1eeua_: 1eeu A: [20546]
    VL dimer of Bence-Jones protein LEN
    complexed with ipa; mutant

Details for d1eeua_

PDB Entry: 1eeu (more details), 1.6 Å

PDB Description: m4l/y(27d)d/q89d/t94h mutant of len
PDB Compounds: (A:) kappa-4 immunoglobulin (light chain)

SCOPe Domain Sequences for d1eeua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeua_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtklei

SCOPe Domain Coordinates for d1eeua_:

Click to download the PDB-style file with coordinates for d1eeua_.
(The format of our PDB-style files is described here.)

Timeline for d1eeua_: