SCOP 1.75: Domain d1eeua_: 1eeu A:

Lineage for d1eeua_ (1eeu A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)

8. Domain d1eeua_: 1eeu A: [20546]
   VL dimer of Bence-Jones protein LEN

Details for d1eeua_

PDB Entry: 1eeu, 1.6 Å

PDB Description: m4l/y(27d)d/q89d/t94h mutant of len

PDB Compounds: (A:) kappa-4 immunoglobulin (light chain)

SCOP Domain Sequences for d1eeua_:

Sequence; same for both SEQRES and ATOM records:

>d1eeua_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtklei

Timeline for d1eeua_:

• d1eeua_ first appeared (with stable ids) in SCOP 1.55
  
• d1eeua_ appears in SCOP 1.73
  
• d1eeua_ appears in SCOPe 2.01
  
• d1eeua_ appears in the current release, SCOPe 2.08