Lineage for d1eeua_ (1eeu A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102237Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries)
  8. 102240Domain d1eeua_: 1eeu A: [20546]

Details for d1eeua_

PDB Entry: 1eeu (more details), 1.6 Å

PDB Description: m4l/y(27d)d/q89d/t94h mutant of len

SCOP Domain Sequences for d1eeua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeua_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)}
divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtklei

SCOP Domain Coordinates for d1eeua_:

Click to download the PDB-style file with coordinates for d1eeua_.
(The format of our PDB-style files is described here.)

Timeline for d1eeua_: