Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Bence-Jones VL (kappa) domain LEN (human) [48925] (9 PDB entries) |
Domain d1eeqb_: 1eeq B: [20545] |
PDB Entry: 1eeq (more details), 1.5 Å
SCOP Domain Sequences for d1eeqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eeqb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) domain LEN (human)} divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyshpysfgqgtkleik
Timeline for d1eeqb_: