SCOP 1.59: Domain d1bree_: 1bre E:

Lineage for d1bree_ (1bre E:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Bence-Jones VL (kappa) dimer BRE (human) [48924] (3 PDB entries)

8. Domain d1bree_: 1bre E: [20542]

Details for d1bree_

PDB Entry: 1bre, 2 Å

PDB Description: immunoglobulin light chain protein

SCOP Domain Sequences for d1bree_:

Sequence; same for both SEQRES and ATOM records:

>d1bree_ b.1.1.1 (E:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer BRE (human)}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

Timeline for d1bree_:

• d1bree_ first appeared (with stable ids) in SCOP 1.55
  
• d1bree_ appears in SCOP 1.57
  
• d1bree_ appears in SCOP 1.61
  
• d1bree_ appears in the current release, SCOPe 2.08