Lineage for d2p1yg1 (2p1y G:3-116)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024837Domain d2p1yg1: 2p1y G:3-116 [205413]
    Other proteins in same PDB: d2p1ya2, d2p1yc2, d2p1ye2, d2p1yg2
    automated match to d1bwma2

Details for d2p1yg1

PDB Entry: 2p1y (more details), 2.42 Å

PDB Description: 1.B2.D9, a bispecific alpha/beta TCR
PDB Compounds: (G:) bispecific alpha/beta TCR

SCOPe Domain Sequences for d2p1yg1:

Sequence, based on SEQRES records: (download)

>d2p1yg1 b.1.1.1 (G:3-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdlgqtnerlffghgtklsvl

Sequence, based on observed residues (ATOM records): (download)

>d2p1yg1 b.1.1.1 (G:3-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdrlffghgtklsvl

SCOPe Domain Coordinates for d2p1yg1:

Click to download the PDB-style file with coordinates for d2p1yg1.
(The format of our PDB-style files is described here.)

Timeline for d2p1yg1: