Lineage for d2p1ma2 (2p1m A:101-160)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735465Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2735466Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2735513Family a.157.1.0: automated matches [227205] (1 protein)
    not a true family
  6. 2735514Protein automated matches [226937] (1 species)
    not a true protein
  7. 2735515Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries)
  8. 2735516Domain d2p1ma2: 2p1m A:101-160 [205408]
    Other proteins in same PDB: d2p1ma1
    automated match to d1p22b1
    complexed with ihp

Details for d2p1ma2

PDB Entry: 2p1m (more details), 1.8 Å

PDB Description: tir1-ask1 complex structure
PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d2p1ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p1ma2 a.157.1.0 (A:101-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lilaanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeeevrrenqwafe

SCOPe Domain Coordinates for d2p1ma2:

Click to download the PDB-style file with coordinates for d2p1ma2.
(The format of our PDB-style files is described here.)

Timeline for d2p1ma2: