Lineage for d2p0ab1 (2p0a B:90-192)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360440Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1360441Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1360707Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1360708Protein automated matches [226903] (19 species)
    not a true protein
  7. 1360728Species Human (Homo sapiens) [TaxId:9606] [225246] (1 PDB entry)
  8. 1360730Domain d2p0ab1: 2p0a B:90-192 [205403]
    Other proteins in same PDB: d2p0aa2, d2p0ab2
    automated match to d1i7na1
    complexed with anp, cl, edo, so4

Details for d2p0ab1

PDB Entry: 2p0a (more details), 1.9 Å

PDB Description: the crystal structure of human synapsin iii (syn3) in complex with amppnp
PDB Compounds: (B:) Synapsin-3

SCOPe Domain Sequences for d2p0ab1:

Sequence, based on SEQRES records: (download)

>d2p0ab1 c.30.1.0 (B:90-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rprillviddahtdwskyfhgkkvngeieirveqaefselnlaayvtggcmvdmqvvrng
tkvvsrsfkpdfilvrqhaysmalgedyrslviglqygglpav

Sequence, based on observed residues (ATOM records): (download)

>d2p0ab1 c.30.1.0 (B:90-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rprillviddahtdwskyfhgkkvngeieirveqaefselnlaayvtggcmvdmqrsfkp
dfilvrqhaysmalgedyrslviglqygglpav

SCOPe Domain Coordinates for d2p0ab1:

Click to download the PDB-style file with coordinates for d2p0ab1.
(The format of our PDB-style files is described here.)

Timeline for d2p0ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p0ab2